Rabbit anti-Human VCAM1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12991P

• Product Name:
• Rabbit anti-Human VCAM1 Polyclonal Antibody

• Synonym:
• CD106; INCAM-100; VCAM1

• Description:
• The antibody against VCAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human VCAM1 (NP_001069.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300-400 of human VCAM1 (NP_001069.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• VCAM1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL

• Gene ID:
• 7412

• Uniprot-ID:
• P19320

• Purification Method:
• Affinity purification

• Positive Samples:
• HUVEC, Mouse liver