Rabbit anti-Human USB1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03535P

• Product Name:
• Rabbit anti-Human USB1 Polyclonal Antibody

• Synonym:
• PN; Mpn1; HVSL1; hMpn1; hUsb1; C16orf57; USB1

• Description:
• The antibody against USB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human USB1 (NP_078874.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human USB1 (NP_078874.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• USB1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK

• Gene ID:
• 79650

• Uniprot-ID:
• Q9BQ65

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-431, HeLa, Mouse liver