Rabbit anti-Human UROD Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03763P

• Product Name:
• Rabbit anti-Human UROD Polyclonal Antibody

• Synonym:
• PCT; UPD; UROD

• Description:
• The antibody against UROD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-367 of human UROD (NP_000365.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-367 of human UROD (NP_000365.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UROD

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN

• Gene ID:
• 7389

• Uniprot-ID:
• P06132

• Purification Method:
• Affinity purification

• Positive Samples:
• SW620, K-562, SW480, Mouse liver, Mouse kidney, Mouse testis, Mouse heart, HepG2