Rabbit anti-Human UQCR10 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03909P

• Product Name:
• Rabbit anti-Human UQCR10 Polyclonal Antibody

• Synonym:
• QCR9; UCRC; HSPC051; HSPC119; HSPC151; UCCR7.2; UQCR10

• Description:
• The antibody against UQCR10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UQCR10

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

• Gene ID:
• 29796

• Uniprot-ID:
• Q9UDW1

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, 22Rv1, Jurkat, NCI-H460