Rabbit anti-Human UQCC2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00829P

• Product Name:
• Rabbit anti-Human UQCC2 Polyclonal Antibody

• Synonym:
• M19; Cbp6; MNF1; MC3DN7; C6orf125; C6orf126; bA6B20.2; UQCC2

• Description:
• The antibody against UQCC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UQCC2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA

• Gene ID:
• 84300

• Uniprot-ID:
• Q9BRT2

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, THP-1, HepG2, U-251MG, Mouse heart, Mouse brain, Mouse testis, Rat brain