Rabbit anti-Human UPF1/RENT1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06186P

• Product Name:
• Rabbit anti-Human UPF1/RENT1 Polyclonal Antibody

• Synonym:
• UTF; HUPF1; NORF1; RENT1; smg-2; pNORF1; UPF1/RENT1

• Description:
• The antibody against UPF1/RENT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 270-370 of human UPF1/RENT1 (NP_002902.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 270-370 of human UPF1/RENT1 (NP_002902.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UPF1/RENT1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDMRLMQGDEICLRYKGDL

• Gene ID:
• 5976

• Uniprot-ID:
• Q92900

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2