Rabbit anti-Human UNC93B1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10121P

• Product Name:
• Rabbit anti-Human UNC93B1 Polyclonal Antibody

• Synonym:
• IIAE1; UNC93; UNC93B; Unc-93B1; UNC93B1

• Description:
• The antibody against UNC93B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UNC93B1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDES

• Gene ID:
• 81622

• Uniprot-ID:
• Q9H1C4

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HeLa, Mouse kidney, Mouse lung, Mouse spleen, Rat kidney, Rat lung, Rat spleen