Rabbit anti-Human UMPS Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03549P

• Product Name:
• Rabbit anti-Human UMPS Polyclonal Antibody

• Synonym:
• OPRT; UMPS

• Description:
• The antibody against UMPS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human UMPS (NP_000364.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human UMPS (NP_000364.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UMPS

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADV

• Gene ID:
• 7372

• Uniprot-ID:
• P11172

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-29, U-87MG, HeLa, LO2, Mouse brain, Mouse kidney