Rabbit anti-Human UGT2B17 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07606P

• Product Name:
• Rabbit anti-Human UGT2B17 Polyclonal Antibody

• Synonym:
• BMND12; UDPGT2B17; UGT2B17

• Description:
• The antibody against UGT2B17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human UGT2B17 (NP_001068.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human UGT2B17 (NP_001068.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UGT2B17

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMS

• Gene ID:
• 7367

• Uniprot-ID:
• O75795

• Purification Method:
• Affinity purification