Rabbit anti-Human UGT1A4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04790P

• Product Name:
• Rabbit anti-Human UGT1A4 Polyclonal Antibody

• Synonym:
• GNT1; UGT1; UDPGT; UGT1A; UGT1D; UGT-1A; UGT-1D; UGT1.1; UGT1.4; UGT1A1; HUG-BR2; UGT1-01; UGT1-04; UGT1A4S; hUG-BR1; UDPGT 1-4; UGT1A4

• Description:
• The antibody against UGT1A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UGT1A4 (NP_009051.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UGT1A4 (NP_009051.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UGT1A4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGF

• Gene ID:
• 54657

• Uniprot-ID:
• P22310

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse liver, Mouse stomach, Rat liver