Rabbit anti-Human UGT1A10 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00210P

• Product Name:
• Rabbit anti-Human UGT1A10 Polyclonal Antibody

• Synonym:
• GNT1; UGT1; UDPGT; UGT1A; UGT1J; UGT-1A; UGT-1J; UGT1.1; UGT1A1; UGT1-01; UGT1-10; UGT1.10; hUG-BR1; UGT1A10

• Description:
• The antibody against UGT1A10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human UGT1A10 (NP_061948.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50-150 of human UGT1A10 (NP_061948.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UGT1A10

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LRGHEVVVVMPEVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKESSFDAVFLDPF

• Gene ID:
• 54575

• Uniprot-ID:
• Q9HAW8

• Purification Method:
• Affinity purification

• Positive Samples:
• LO2, 293T, A375