Rabbit anti-Human UCP1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13020P

• Product Name:
• Rabbit anti-Human UCP1 Polyclonal Antibody

• Synonym:
• UCP; SLC25A7; UCP1

• Description:
• The antibody against UCP1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-307 of human UCP1 (NP_068605.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-307 of human UCP1 (NP_068605.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UCP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

• Gene ID:
• 7350

• Uniprot-ID:
• P25874

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brown adipose