Rabbit anti-Human UBL4A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03993P

• Product Name:
• Rabbit anti-Human UBL4A Polyclonal Antibody

• Synonym:
• GDX; G6PD; GET5; MDY2; UBL4; TMA24; DX254E; DXS254E; UBL4A

• Description:
• The antibody against UBL4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UBL4A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

• Gene ID:
• 8266

• Uniprot-ID:
• P11441

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, A-549, U-87MG, Mouse brain, Mouse kidney