Rabbit anti-Human UBE2V2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02752P

• Product Name:
• Rabbit anti-Human UBE2V2 Polyclonal Antibody

• Synonym:
• MMS2; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1; UBE2V2

• Description:
• The antibody against UBE2V2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human UBE2V2 (NP_003341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human UBE2V2 (NP_003341.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UBE2V2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

• Gene ID:
• 7336

• Uniprot-ID:
• Q15819

• Purification Method:
• Affinity purification

• Positive Samples:
• SW480, SKOV3, HeLa, HL-60, Mouse liver, Mouse skin, Rat liver, Rat brain