Rabbit anti-Human UBE2K Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01712P

• Product Name:
• Rabbit anti-Human UBE2K Polyclonal Antibody

• Synonym:
• LIG; HIP2; HYPG; UBC1; E2-25K; UBE2K

• Description:
• The antibody against UBE2K was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2K (NP_005330.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2K (NP_005330.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UBE2K

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQW

• Gene ID:
• 3093

• Uniprot-ID:
• P61086

• Purification Method:
• Affinity purification

• Positive Samples:
• 22Rv1, SKOV3, SW480, HL-60, Raji, U-251MG, MCF7