Rabbit anti-Human UBE2H Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02564P

• Product Name:
• Rabbit anti-Human UBE2H Polyclonal Antibody

• Synonym:
• GID3; UBC8; UBCH; UBCH2; E2-20K; UBE2H

• Description:
• The antibody against UBE2H was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human UBE2H (NP_003335.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human UBE2H (NP_003335.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• UBE2H

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL

• Gene ID:
• 7328

• Uniprot-ID:
• P62256

• Purification Method:
• Affinity purification

• Positive Samples:
• SW480, BT-474, 293T, U-251MG, SKOV3, Mouse thymus, Mouse liver, Mouse lung, Rat lung