Rabbit anti-Human TSPAN7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03036P

• Product Name:
• Rabbit anti-Human TSPAN7 Polyclonal Antibody

• Synonym:
• A15; MXS1; CD231; MRX58; CCG-B7; TM4SF2; XLID58; TALLA-1; TM4SF2b; DXS1692E; TSPAN7

• Description:
• The antibody against TSPAN7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human TSPAN7 (NP_004606.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human TSPAN7 (NP_004606.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TSPAN7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF

• Gene ID:
• 7102

• Uniprot-ID:
• P41732

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse spleen