Rabbit anti-Human TSG101/VPS23 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12951P

• Product Name:
• Rabbit anti-Human TSG101/VPS23 Polyclonal Antibody

• Synonym:
• TSG10; VPS23; TSG101/VPS23

• Description:
• The antibody against TSG101/VPS23 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101/VPS23 (NP_006283.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101/VPS23 (NP_006283.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TSG101/VPS23

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

• Gene ID:
• 7251

• Uniprot-ID:
• Q99816

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y, K-562