Rabbit anti-Human TRPV1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12885P

• Product Name:
• Rabbit anti-Human TRPV1 Polyclonal Antibody

• Synonym:
• VR1; TRPV1

• Description:
• The antibody against TRPV1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 725-839 of human TRPV1 (NP_061197.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 725-839 of human TRPV1 (NP_061197.4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TRPV1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KLLQVGYTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRSSRVSGRHWKNFALVPLLREASARDRQSAQPEEVYLRQFSGSLKPEDAEVFKSPAASGEK

• Gene ID:
• 7442

• Uniprot-ID:
• Q8NER1

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain