Rabbit anti-Human TRMT2A/HTF9C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03613P

• Product Name:
• Rabbit anti-Human TRMT2A/HTF9C Polyclonal Antibody

• Synonym:
• HTF9C; TRMT2A/HTF9C

• Description:
• The antibody against TRMT2A/HTF9C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TRMT2A/HTF9C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS

• Gene ID:
• 27037

• Uniprot-ID:
• Q8IZ69

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HeLa, K-562