• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human TRMT2A/HTF9C Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-02688P
  • Product Name:
  • Rabbit anti-Human TRMT2A/HTF9C Polyclonal Antibody
  • Synonym:
  • HTF9C; TRMT2A/HTF9C
  • Description:
  • The antibody against TRMT2A/HTF9C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • TRMT2A/HTF9C
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • LASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS
  • Gene ID:
  • 27037
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • K-562
  • Pre product:Rabbit anti-Human TES Polyclonal Antibody-ADA-02687P
  • Online Inquiry

    refresh