Rabbit anti-Human TRIP4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05117P

• Product Name:
• Rabbit anti-Human TRIP4 Polyclonal Antibody

• Synonym:
• ASC1; ASC-1; MDCDC; SMABF1; ZC2HC5; HsT17391; TRIP4

• Description:
• The antibody against TRIP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 282-581 of human TRIP4 (NP_057297.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 282-581 of human TRIP4 (NP_057297.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TRIP4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV

• Gene ID:
• 9325

• Uniprot-ID:
• Q15650

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, HeLa, LO2, Mouse liver, Mouse testis, Mouse brain, Rat testis, Rat brain