Rabbit anti-Human TP53BP2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09656P

• Product Name:
• Rabbit anti-Human TP53BP2 Polyclonal Antibody

• Synonym:
• BBP; 53BP2; ASPP2; P53BP2; PPP1R13A; TP53BP2

• Description:
• The antibody against TP53BP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-600 of human TP53BP2 (NP_001026855.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 360-600 of human TP53BP2 (NP_001026855.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TP53BP2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• STMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTL

• Gene ID:
• 7159

• Uniprot-ID:
• Q13625

• Purification Method:
• Affinity purification