Rabbit anti-Human TNRC6A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08659P

• Product Name:
• Rabbit anti-Human TNRC6A Polyclonal Antibody

• Synonym:
• GW1; FAME6; GW182; TNRC6; CAGH26; TNRC6A

• Description:
• The antibody against TNRC6A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TNRC6A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS

• Gene ID:
• 27327

• Uniprot-ID:
• Q8NDV7

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Rat brain