Rabbit anti-Human TNFR1/TNFRSF1A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12581P

• Product Name:
• Rabbit anti-Human TNFR1/TNFRSF1A Polyclonal Antibody

• Synonym:
• FPF; p55; p60; TBP1; TNF-R; TNFAR; TNFR1; p55-R; CD120a; TNFR55; TNFR60; TNF-R-I; TNF-R55; TNFR1/TNFRSF1A

• Description:
• The antibody against TNFR1/TNFRSF1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human TNFR1/TNFRSF1A (NP_001056.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 345-455 of human TNFR1/TNFRSF1A (NP_001056.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TNFR1/TNFRSF1A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR

• Gene ID:
• 7132

• Uniprot-ID:
• P19438

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, C6