Rabbit anti-Human TMEM184A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01911P

• Product Name:
• Rabbit anti-Human TMEM184A Polyclonal Antibody

• Synonym:
• SDMG1; TMEM184A

• Description:
• The antibody against TMEM184A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 324-413 of human TMEM184A (NP_001091089.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 324-413 of human TMEM184A (NP_001091089.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TMEM184A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL

• Gene ID:
• 202915

• Uniprot-ID:
• Q6ZMB5

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, Mouse liver, Mouse kidney, Rat lung