Rabbit anti-Human TIMM13 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08099P

• Product Name:
• Rabbit anti-Human TIMM13 Polyclonal Antibody

• Synonym:
• ppv1; TIM13; TIM13B; TIMM13A; TIMM13B; TIMM13

• Description:
• The antibody against TIMM13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human TIMM13（NP_036590.1） as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human TIMM13（NP_036590.1）.

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TIMM13

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM

• Gene ID:
• 26517

• Uniprot-ID:
• Q9Y5L4

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat kidney