Rabbit anti-Human TIM-3/HAVCR2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06242P

• Product Name:
• Rabbit anti-Human TIM-3/HAVCR2 Polyclonal Antibody

• Synonym:
• TIM3; CD366; KIM-3; SPTCL; TIMD3; Tim-3; TIMD-3; HAVcr-2; TIM-3/HAVCR2

• Description:
• The antibody against TIM-3/HAVCR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIM-3/HAVCR2 (NP_116171.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIM-3/HAVCR2 (NP_116171.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TIM-3/HAVCR2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENV

• Gene ID:
• 84868

• Uniprot-ID:
• Q8TDQ0

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji, Mouse spleen