Rabbit anti-Human THRA Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03741P

• Product Name:
• Rabbit anti-Human THRA Polyclonal Antibody

• Synonym:
• AR7; EAR7; ERBA; CHNG6; ERBA1; NR1A1; THRA1; THRA2; c-erbA; ERB-T-1; TRalpha; THRalpha; TRalpha1; TRalpha2; c-ERBA-1; THRalpha1; THRalpha2; THRA

• Description:
• The antibody against THRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 138-180 of human THRA (NP_003241.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 138-180 of human THRA (NP_003241.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• THRA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA

• Gene ID:
• 7067

• Uniprot-ID:
• P10827

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y