Rabbit anti-Human THOC7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10282P

• Product Name:
• Rabbit anti-Human THOC7 Polyclonal Antibody

• Synonym:
• fSAP24; hTREX30; NIF3L1BP1; THOC7

• Description:
• The antibody against THOC7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-204 of human THOC7 (NP_079351.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-204 of human THOC7 (NP_079351.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• THOC7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP

• Gene ID:
• 80145

• Uniprot-ID:
• Q6I9Y2

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-29, A-431, 293T, Jurkat, Mouse kidney, Rat brain