Rabbit anti-Human Thioredoxin reductase 1 (TXNRD1 ) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11665P

• Product Name:
• Rabbit anti-Human Thioredoxin reductase 1 (TXNRD1 ) Polyclonal Antibody

• Synonym:
• TR; TR1; TXNR; TRXR1; GRIM-12; Thioredoxin reductase 1 (TXNRD1 )

• Description:
• The antibody against Thioredoxin reductase 1 (TXNRD1 ) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-490 of human Thioredoxin reductase 1 (TXNRD1) (NP_001087240.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 410-490 of human Thioredoxin reductase 1 (TXNRD1) (NP_001087240.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Thioredoxin reductase 1 (TXNRD1 )

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKV

• Gene ID:
• 7296

• Uniprot-ID:
• Q16881

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, BxPC-3, Mouse heart