Rabbit anti-Human Thioredoxin 2 (Trx2/TXN2) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10326P

• Product Name:
• Rabbit anti-Human Thioredoxin 2 (Trx2/TXN2) Polyclonal Antibody

• Synonym:
• TXN; MTRX; TRX2; MT-TRX; COXPD29; Thioredoxin 2 (Trx2/TXN2)

• Description:
• The antibody against Thioredoxin 2 (Trx2/TXN2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human Thioredoxin 2 (Trx2/Thioredoxin 2 (Trx2/TXN2)) (NP_036605.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human Thioredoxin 2 (Trx2/Thioredoxin 2 (Trx2/TXN2)) (NP_036605.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Thioredoxin 2 (Trx2/TXN2)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

• Gene ID:
• 25828

• Uniprot-ID:
• Q99757

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji, 293T, SW620, Mouse liver, Mouse brain, Mouse bone marrow