Rabbit anti-Human TGF beta induced (TGFBI) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01751P

• Product Name:
• Rabbit anti-Human TGF beta induced (TGFBI) Polyclonal Antibody

• Synonym:
• CSD; CDB1; CDG2; CSD1; CSD2; CSD3; EBMD; LCD1; BIGH3; CDGG1; TGF beta induced (TGFBI)

• Description:
• The antibody against TGF beta induced (TGFBI) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human TGF beta induced (TGFBI) (NP_000349.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 550-650 of human TGF beta induced (TGFBI) (NP_000349.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TGF beta induced (TGFBI)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

• Gene ID:
• 7045

• Uniprot-ID:
• Q15582

• Purification Method:
• Affinity purification

• Positive Samples:
• SKOV3, Mouse eye, Mouse spleen