Rabbit anti-Human TEX101 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06867P

• Product Name:
• Rabbit anti-Human TEX101 Polyclonal Antibody

• Synonym:
• SGRG; CT131; GTPR867; NYD-SP8; PRO1884; SPATA44; TES101RP; TEX101

• Description:
• The antibody against TEX101 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-150 of human TEX101 (NP_113639.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 44-150 of human TEX101 (NP_113639.4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TEX101

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTAS

• Gene ID:
• 83639

• Uniprot-ID:
• Q9BY14

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549