Rabbit anti-Human Tenascin C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02362P

• Product Name:
• Rabbit anti-Human Tenascin C Polyclonal Antibody

• Synonym:
• GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225; Tenascin C

• Description:
• The antibody against Tenascin C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1990-2201 of human Tenascin C (NP_002151.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1990-2201 of human Tenascin C (NP_002151.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Tenascin C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

• Gene ID:
• 3371

• Uniprot-ID:
• P24821

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain