Rabbit anti-Human TEAD4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12135P

• Product Name:
• Rabbit anti-Human TEAD4 Polyclonal Antibody

• Synonym:
• TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; TCF13L1; hRTEF-1B; TEAD4

• Description:
• The antibody against TEAD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TEAD4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI

• Gene ID:
• 7004

• Uniprot-ID:
• Q15561

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, K-562, SW620, HeLa, Mouse lung, Mouse skeletal muscle, Mouse liver, Rat lung, Rat liver