Rabbit anti-Human TDP2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01988P

• Product Name:
• Rabbit anti-Human TDP2 Polyclonal Antibody

• Synonym:
• EAP2; AD022; EAPII; TTRAP; hTDP2; dJ30M3.3; TDP2

• Description:
• The antibody against TDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TDP2 (NP_057698.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TDP2 (NP_057698.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TDP2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP

• Gene ID:
• 51567

• Uniprot-ID:
• O95551

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, HeLa, Mouse brain