Rabbit anti-Human TCEAL2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03494P

• Product Name:
• Rabbit anti-Human TCEAL2 Polyclonal Antibody

• Synonym:
• WEX1; my048; MY0876G05; TCEAL2

• Description:
• The antibody against TCEAL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TCEAL2 (NP_525129.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TCEAL2 (NP_525129.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TCEAL2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKAKGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSER

• Gene ID:
• 140597

• Uniprot-ID:
• Q9H3H9

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain