Rabbit anti-Human TAOK2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04689P

• Product Name:
• Rabbit anti-Human TAOK2 Polyclonal Antibody

• Synonym:
• PSK; PSK1; TAO1; TAO2; MAP3K17; Tao2beta; PSK1-BETA; TAOK2

• Description:
• The antibody against TAOK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 610-730 of human TAOK2 (NP_057235.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 610-730 of human TAOK2 (NP_057235.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TAOK2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ

• Gene ID:
• 9344

• Uniprot-ID:
• Q9UL54

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, 293T