Rabbit anti-Human Tafazzin / TAZ Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03204P

• Product Name:
• Rabbit anti-Human Tafazzin / TAZ Polyclonal Antibody

• Synonym:
• EFE; TAZ; BTHS; EFE2; G4.5; Taz1; CMD3A; LVNCX; Tafazzin / TAZ

• Description:
• The antibody against Tafazzin / TAZ was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 174-248 of human Tafazzin / TAZ (NP_851830.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 174-248 of human Tafazzin / TAZ (NP_851830.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Tafazzin / TAZ

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHL

• Gene ID:
• 6901

• Uniprot-ID:
• Q16635

• Purification Method:
• Affinity purification

• Positive Samples:
• NCI-H460, Rat skeletal muscle, Mouse heart