Rabbit anti-Human TAB1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11184P

• Product Name:
• Rabbit anti-Human TAB1 Polyclonal Antibody

• Synonym:
• 3'-Tab1; MAP3K7IP1; TAB1

• Description:
• The antibody against TAB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 205-504 of human TAB1 (NP_006107.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 205-504 of human TAB1 (NP_006107.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TAB1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP

• Gene ID:
• 10454

• Uniprot-ID:
• Q15750

• Purification Method:
• Affinity purification

• Positive Samples:
• HL-60, MCF7, A-431, U-251MG, HeLa, Mouse kidney, Mouse heart, Mouse thymus