Rabbit anti-Human SUPT6H Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00285P

• Product Name:
• Rabbit anti-Human SUPT6H Polyclonal Antibody

• Synonym:
• SPT6; SPT6H; emb-5; SUPT6H

• Description:
• The antibody against SUPT6H was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1500-1726 of human SUPT6H (NP_003161.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1500-1726 of human SUPT6H (NP_003161.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SUPT6H

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IFPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMTSQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR

• Gene ID:
• 6830

• Uniprot-ID:
• Q7KZ85

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, Jurkat, HeLa, Mouse brain, Mouse heart, Mouse liver