Rabbit anti-Human SUPT20H Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02548P

• Product Name:
• Rabbit anti-Human SUPT20H Polyclonal Antibody

• Synonym:
• C13; FP757; P38IP; SPT20; FAM48A; C13orf19; SUPT20H

• Description:
• The antibody against SUPT20H was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 580-779 of human SUPT20H (NP_001014308.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 580-779 of human SUPT20H (NP_001014308.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SUPT20H

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMKRGTPTTPKF

• Gene ID:
• 55578

• Uniprot-ID:
• Q8NEM7

• Purification Method:
• Affinity purification

• Positive Samples:
• SW480, HL-60, Mouse testis, Mouse brain, Mouse lung, Rat kidney, Rat brain