Rabbit anti-Human SUMO4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04182P

• Product Name:
• Rabbit anti-Human SUMO4 Polyclonal Antibody

• Synonym:
• IDDM5; SMT3H4; SUMO-4; dJ281H8.4; SUMO4

• Description:
• The antibody against SUMO4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-95 of human SUMO4 (Q6EEV6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 40-95 of human SUMO4 (Q6EEV6).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SUMO4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY

• Gene ID:
• 387082

• Uniprot-ID:
• Q6EEV6

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, MCF7