Rabbit anti-Human SUMO3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09824P

• Product Name:
• Rabbit anti-Human SUMO3 Polyclonal Antibody

• Synonym:
• SMT3A; Smt3B; SMT3H1; SUMO-3; SUMO3

• Description:
• The antibody against SUMO3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SUMO3 (NP_008867.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SUMO3 (NP_008867.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SUMO3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAG

• Gene ID:
• 6612

• Uniprot-ID:
• P55854

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7