Rabbit anti-Human SUMO2/3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05201P

• Product Name:
• Rabbit anti-Human SUMO2/3 Polyclonal Antibody

• Synonym:
• HSMT3; SMT3B; SUMO3; Smt3A; SMT3H2; SUMO2/3

• Description:
• The antibody against SUMO2/3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2/3 (NP_008868.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2/3 (NP_008868.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SUMO2/3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

• Gene ID:
• 6613

• Uniprot-ID:
• P61956

• Purification Method:
• Affinity purification

• Positive Samples:
• PC-12, 293T, Mouse kidney, Mouse brain