Rabbit anti-Human Staufen Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11229P

• Product Name:
• Rabbit anti-Human Staufen Polyclonal Antibody

• Synonym:
• STAU; PPP1R150; Staufen

• Description:
• The antibody against Staufen was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 426-577 of human Staufen (NP_059347.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 426-577 of human Staufen (NP_059347.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Staufen

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC

• Gene ID:
• 6780

• Uniprot-ID:
• O95793

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse liver, Mouse brain, Mouse testis