Rabbit anti-Human STAT5A/STAT5B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07159P

• Product Name:
• Rabbit anti-Human STAT5A/STAT5B Polyclonal Antibody

• Synonym:
• MGF; STAT5; stat5a/stat5b; STAT5A/STAT5B

• Description:
• The antibody against STAT5A/STAT5B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-787 of human STAT5A/STAT5B (NP_036580.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 700-787 of human STAT5A/STAT5B (NP_036580.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• STAT5A/STAT5B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS

• Gene ID:
• 67766777

• Purification Method:
• Affinity purification

• Positive Samples:
• mouse kidney