Rabbit anti-Human STAT2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05323P

• Product Name:
• Rabbit anti-Human STAT2 Polyclonal Antibody

• Synonym:
• P113; IMD44; ISGF-3; PTORCH3; STAT113; STAT2

• Description:
• The antibody against STAT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• STAT2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL

• Gene ID:
• 6773

• Uniprot-ID:
• P52630

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, A-431, U-937, Mouse brain, Rat liver, Rat testis