Rabbit anti-Human SSCA1/SerpinB3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03789P

• Product Name:
• Rabbit anti-Human SSCA1/SerpinB3 Polyclonal Antibody

• Synonym:
• SCC; T4-A; SCCA1; SSCA1; SCCA-1; HsT1196; SCCA-PD; SSCA1/SerpinB3

• Description:
• The antibody against SSCA1/SerpinB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-390 of human SSCA1/SerpinB3 (NP_008850.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 2-390 of human SSCA1/SerpinB3 (NP_008850.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SSCA1/SerpinB3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

• Gene ID:
• 6317

• Uniprot-ID:
• P29508

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T transfected with SSCA1/SerpinB3